PDB entry 2plh

View 2plh on RCSB PDB site
Description: structure of alpha-1-purothionin at room temperature and 2.8 angstroms resolution
Deposited on 1993-07-09, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.155
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2plh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2plh_ (-)
    ksccrstlgrncynlcrargaqklcagvcrckissglscpkgfpk