PDB entry 2ple

View 2ple on RCSB PDB site
Description: nuclear magnetic resonance structure of an sh2 domain of phospholipase c-gamma1 complexed with a high affinity binding peptide
Class: phosphoric diester hydrolase
Keywords: phosphoric diester hydrolase
Deposited on 1994-08-19, released 1995-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c gamma-1, c-terminal sh2 domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2plea1, d2plea2, d2plea3
  • Chain 'B':
    Compound: phosphopeptide from pdgf
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pleA (A:)
gspgiheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrv
qqegqtvmlgnsefdslvdlisyyekhplyrkmklrypineenss

  • Chain 'B':
    No sequence available.