PDB entry 2plc

View 2plc on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
Deposited on 1997-07-09, released 1998-01-14
The last revision prior to the SCOP 1.71 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2plc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2plc_ (-)
    vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
    idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
    pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
    viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
    vlnltsekvrglgilimdfpekqtikniiknnkf