PDB entry 2plc

View 2plc on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
Class: hydrolase
Keywords: hydrolase, phospholipid degradation, virulence factor of human pathogen
Deposited on 1997-07-09, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-specific phospholipase c
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: PLCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2plca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2plcA (A:)
vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
vlnltsekvrglgilimdfpekqtikniiknnkf