PDB entry 2pla

View 2pla on RCSB PDB site
Description: Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein
Class: oxidoreductase
Keywords: dehydrogenase, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2007-04-19, released 2007-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase 1-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2plaa1, d2plaa2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase 1-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GPD1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2plab1
  • Heterogens: PO4, CL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2plaA (A:)
    maaaplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndh
    envkylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitl
    ikgidegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfk
    ellqtpnfritvvddadtvelcgalknivavgagfcdglrcgdntkaavirlglmemiaf
    arifckgqvstatflescgvadlittcyggrnrrvaeafartgktieelekemlngqklq
    gpqtsaevyrilkqkglldkfplftavyqicyesrpvqemlsclqshpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2plaA (A:)
    aplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndhenv
    kylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitlikg
    idegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfkell
    qtpnfritvvddadtvelcgalknivavgagfcdglrcgdntkaavirlglmemiafari
    fckgqvstatflescgvadlittcyggrnrrvaeafartgktieelekemlngqklqgpq
    tsaevyrilkqkglldkfplftavyqicyesrpvqemlsclqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2plaB (B:)
    maaaplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndh
    envkylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitl
    ikgidegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfk
    ellqtpnfritvvddadtvelcgalknivavgagfcdglrcgdntkaavirlglmemiaf
    arifckgqvstatflescgvadlittcyggrnrrvaeafartgktieelekemlngqklq
    gpqtsaevyrilkqkglldkfplftavyqicyesrpvqemlsclqshpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2plaB (B:)
    aplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndhenv
    kylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitlikg
    idegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfkell
    qtpnfritvvddadtvelcgalknivavgagfcdglrcgdntkaavirlglmemiafari
    fckgqvstatflescgvadlittcyggrnrrvaeafartgktieelekemlngqklqgpq
    tsaevyrilkqkglldkfplftavyqicyesrpvqemlsclqs