PDB entry 2pl7

View 2pl7 on RCSB PDB site
Description: Orhorhombic crystal structure of hydrophobin HFBII in the presence of a detergent
Class: surface active protein
Keywords: hydrophobin, amphiphile, protein surfactant, SURFACE ACTIVE PROTEIN
Deposited on 2007-04-19, released 2007-07-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.18
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl7a_
  • Chain 'B':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl7b_
  • Heterogens: SO4, HTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pl7A (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pl7A (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pl7B (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pl7B (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqka