PDB entry 2pl6

View 2pl6 on RCSB PDB site
Description: Monoclinic crystal structure of hydrophobin HFBII in presence of a detergent
Class: structural protein
Keywords: hydrophobin, amphiphile, protein surfactant, STRUCTURAL PROTEIN
Deposited on 2007-04-19, released 2007-07-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6a_
  • Chain 'B':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6b_
  • Chain 'C':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6c_
  • Chain 'D':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6d_
  • Chain 'E':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6e_
  • Chain 'F':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6f_
  • Chain 'G':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6g_
  • Chain 'H':
    Compound: Hydrophobin-2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pl6h_
  • Heterogens: HTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6A (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6B (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6C (C:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6D (D:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6E (E:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6F (F:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6G (G:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pl6H (H:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf