PDB entry 2pl0

View 2pl0 on RCSB PDB site
Description: LCK bound to imatinib
Class: transferase
Keywords: kinase phosphorylation, TRANSFERASE
Deposited on 2007-04-18, released 2007-10-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase LCK
    Species: Homo sapiens [TaxId:9606]
    Gene: LCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pl0a_
  • Heterogens: STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pl0A (A:)
    gshmqtqkpqkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsm
    spdaflaeanlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltink
    lldmaaqiaegmafieernyihrdlraanilvsdtlsckiadfglarliedneytarega
    kfpikwtapeainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmv
    rpdncpeelyqlmrlcwkerpedrptfdylrsvledfftategqyqpqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pl0A (A:)
    kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
    lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
    gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
    ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
    qlmrlcwkerpedrptfdylrsvledff