PDB entry 2pkr

View 2pkr on RCSB PDB site
Description: Crystal structure of (A+CTE)4 chimeric form of photosyntetic glyceraldehyde-3-phosphate dehydrogenase, complexed with NADP
Class: oxidoreductase
Keywords: chimeric protein, Rossmann fold, NADP complex, OXIDOREDUCTASE
Deposited on 2007-04-18, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.249
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkra1, d2pkra2
  • Chain 'B':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrb1, d2pkrb2
  • Chain 'C':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrc1, d2pkrc2
  • Chain 'D':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrd1, d2pkrd2
  • Chain 'H':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrh1, d2pkrh2
  • Chain 'I':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkri1, d2pkri2
  • Chain 'L':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrl1, d2pkrl2
  • Chain 'M':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrm1, d2pkrm2
  • Chain 'O':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkro1, d2pkro2
  • Chain 'P':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrp1, d2pkrp2
  • Chain 'Q':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrq1, d2pkrq2
  • Chain 'R':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase Aor
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkrr1, d2pkrr2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pkrA (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrA (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pkrB (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrB (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pkrC (C:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrC (C:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pkrD (D:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrD (D:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pkrH (H:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrH (H:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2pkrI (I:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrI (I:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2pkrL (L:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrL (L:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2pkrM (M:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrM (M:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2pkrO (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrO (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2pkrP (P:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrP (P:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2pkrQ (Q:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrQ (Q:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2pkrR (R:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqglegsvasgdpledfckdnpadee
    cklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkrR (R:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqg