PDB entry 2pkq

View 2pkq on RCSB PDB site
Description: Crystal structure of the photosynthetic A2B2-glyceraldehyde-3-phosphate dehydrogenase, complexed with NADP
Class: oxidoreductase
Keywords: Rossman fold, protein-NADP complex, OXIDOREDUCTASE
Deposited on 2007-04-18, released 2007-06-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.261
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase B
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqo1, d2pkqo2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqp1, d2pkqp2
  • Chain 'Q':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase B
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqq1, d2pkqq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqr1, d2pkqr2
  • Chain 'S':
    Compound: glyceraldehyde-3-phosphate dehydrogenase a
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqs1, d2pkqs2
  • Chain 'T':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase B
    Species: Spinacia oleracea [TaxId:3562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pkqt1, d2pkqt2
  • Heterogens: SO4, NDP

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2pkqO (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpglegsvasgdpledfckdnpa
    deecklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkqO (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpfccklye
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pkqP (P:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2pkqQ (Q:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpglegsvasgdpledfckdnpa
    deecklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkqQ (Q:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpglecklye
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pkqR (R:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2pkqS (S:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkqS (S:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2pkqT (T:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpglegsvasgdpledfckdnpa
    deecklye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkqT (T:)
    klkvaingfgrigrnflrcwhgrkdspldvvvvndsggvksathllkydsilgtfkadvk
    iidnetfsidgkpikvvsnrdplklpwaelgidiviegtgvfvdgpgagkhiqagakkvi
    itapakgsdiptyvvgvnekdyghdvaniisnascttnclapfvkvldeelgivkgtmtt
    thsytgdqrlldashrdlrraraaalnivptstgaakavslvlpqlkgklngialrvptp
    nvsvvdlvvniekvgvtaedvnnafrkaaagplkgvldvcdiplvsvdfrcsdfsstids
    sltmvmggdmvkvvawydnewgysqrvvdladlvankwpglegccklye