PDB entry 2pkp

View 2pkp on RCSB PDB site
Description: Crystal structure of 3-isopropylmalate dehydratase (leuD)from Methhanocaldococcus Jannaschii DSM2661 (MJ1271)
Class: Lyase
Keywords: Beta Barrel, Amino-Acid Biosynthesis, Leucine Biosynthesis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Lyase
Deposited on 2007-04-18, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homoaconitase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: aksE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pkpa_
  • Heterogens: ZN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pkpA (A:)
    miikgrahkfgddvdtdaiipgpylrttdpyelashcmagidenfpkkvkegdvivagen
    fgcgssreqaviaikycgikaviaksfarifyrnainvglipiiantdeikdgdiveidl
    dkeeivitnknktikcetpkglereilaagglvnylkkrkliqskkgvkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkpA (A:)
    miikgrahkfgddvdtdaiipgpylrttdpyelashcmagidenfpkkvkegdvivagen
    fgcgssreqaviaikycgikaviaksfarifyrnainvglipiiantdeikdgdiveidl
    dkeeivitnknktikcetpkglereilaagglvnylkkrkliqskkg