PDB entry 2pkh

View 2pkh on RCSB PDB site
Description: Structural Genomics, the crystal structure of the C-terminal domain of histidine utilization repressor from Pseudomonas syringae pv. tomato str. DC3000
Class: DNA binding protein
Keywords: APC84836, histidine utilization repressor, Pseudomonas syringae pv. tomato str. DC3000, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2007-04-17, released 2007-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkha1
  • Chain 'B':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhb1
  • Chain 'C':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhc1
  • Chain 'D':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhd1
  • Chain 'E':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhe1
  • Chain 'F':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhf1
  • Chain 'G':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhg1
  • Chain 'H':
    Compound: Histidine utilization repressor
    Species: Pseudomonas syringae pv. tomato str. DC3000
    Gene: hutC, PSPTO5172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87UX0 (Start-147)
      • modified residue (13)
      • modified residue (30)
    Domains in SCOP 1.75: d2pkhh1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pkhA (A:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhA (A:)
    rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl
    kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp
    vtaarlihpgsrhrlegrftk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pkhB (B:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhB (B:)
    hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy
    lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq
    pvtaarlihpgsrhrlegrftk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pkhC (C:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhC (C:)
    hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy
    lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq
    pvtaarlihpgsrhrlegrftk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pkhD (D:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhD (D:)
    rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl
    kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp
    vtaarlihpgsrhrlegrftk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pkhE (E:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhE (E:)
    hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy
    lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq
    pvtaarlihpgsrhrlegrftk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pkhF (F:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhF (F:)
    rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl
    kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp
    vtaarlihpgsrhrlegrftk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pkhG (G:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhG (G:)
    rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl
    kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp
    vtaarlihpgsrhrlegrftk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pkhH (H:)
    snaarghrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvna
    qvapdylkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrr
    twsgrqpvtaarlihpgsrhrlegrftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkhH (H:)
    hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy
    lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq
    pvtaarlihpgsrhrlegrftk