PDB entry 2pkg

View 2pkg on RCSB PDB site
Description: Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40
Class: Hydrolase REGULATOR/VIRAL PROTEIN
Keywords: Protein phosphatase 2A, small t antigen, SV40, regulation, Hydrolase REGULATOR/VIRAL PROTEIN COMPLEX
Deposited on 2007-04-17, released 2007-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.247
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pkga1
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP2R1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pkgb1
  • Chain 'C':
    Compound: Small T antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pkgc1
  • Chain 'D':
    Compound: Small T antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pkgd1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pkgA (A:)
    lypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevllal
    aeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahfv
    plvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaaskl
    gefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptlr
    qaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvkef
    cenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllplf
    laqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieympl
    lagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvlam
    sgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkigp
    ildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkgA (A:)
    lypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevllal
    aeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahfv
    plvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaaskl
    gefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptlr
    qaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvkef
    cenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllplf
    laqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieympl
    lagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvlam
    sgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkigp
    ildnstlqsevkpilekltqdqdvdvkyfaqealtvlsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pkgB (B:)
    lypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevllal
    aeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahfv
    plvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaaskl
    gefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptlr
    qaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvkef
    cenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllplf
    laqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieympl
    lagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvlam
    sgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkigp
    ildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkgB (B:)
    lypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevllal
    aeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahfv
    plvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaaskl
    gefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptlr
    qaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvkef
    cenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllplf
    laqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieympl
    lagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvlam
    sgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkigp
    ildnstlqsevkpilekltqdqdvdvkyfaqealtvlsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pkgC (C:)
    slnpgvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrm
    wfgldlcegtlllwcdiigqttyrdlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkgC (C:)
    gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl
    dlcegtlllwcdiigqttyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pkgD (D:)
    slnpgvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrm
    wfgldlcegtlllwcdiigqttyrdlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pkgD (D:)
    gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl
    dlcegtlllwcdiigqttyr