PDB entry 2pka

View 2pka on RCSB PDB site
Description: refined 2 angstroms x-ray crystal structure of porcine pancreatic kallikrein a, a specific trypsin-like serine proteinase. crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin
Class: serine proteinase
Keywords: serine proteinase
Deposited on 1984-05-21, released 1984-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kallikrein a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pka.1
  • Chain 'B':
    Compound: kallikrein a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00752 (Start-148)
      • insertion (54)
      • insertion (76)
      • insertion (80)
      • conflict (144)
    Domains in SCOPe 2.08: d2pka.1
  • Chain 'X':
    Compound: kallikrein a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pka.2
  • Chain 'Y':
    Compound: kallikrein a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00752 (Start-148)
      • insertion (54)
      • insertion (76)
      • insertion (80)
      • conflict (144)
    Domains in SCOPe 2.08: d2pka.2
  • Heterogens: BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pkaA (A:)
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnls

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pkaB (B:)
adgkdyshdlmllrlqspakitdavkvlelptqepelgstceasgwgsiepgpddfefpd
eiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcmgdsggplicngmwqgitsw
ghtpcgsankpsiytklifyldwiddtitenp

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pkaX (X:)
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnls

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pkaY (Y:)
adgkdyshdlmllrlqspakitdavkvlelptqepelgstceasgwgsiepgpddfefpd
eiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcmgdsggplicngmwqgitsw
ghtpcgsankpsiytklifyldwiddtitenp