PDB entry 2pk4

View 2pk4 on RCSB PDB site
Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.25 Å
R-factor: 0.148
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2pk4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pk4_ (-)
    qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
    pwcfttdpsvrweycnlkkc