PDB entry 2pk4

View 2pk4 on RCSB PDB site
Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human plasminogen kringle 4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747 (0-79)
  Domains in SCOPe 2.08: d2pk4a_
• Heterogens: ACA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pk4A (A:)
  qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
  pwcfttdpsvrweycnlkkc