PDB entry 2pk2

View 2pk2 on RCSB PDB site
Description: Cyclin box structure of the P-TEFb subunit Cyclin T1 derived from a fusion complex with EIAV Tat
Class: cell cycle
Keywords: CYCLIN T1, TAT, TAR, TWINNING, TRANSCRIPTION REGULATION P-TEFb, CELL CYCLE
Deposited on 2007-04-17, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.274
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-T1, Protein Tat
    Species: , [TaxId:9606,11665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pk2a1, d2pk2a2
  • Chain 'B':
    Compound: Cyclin-T1, Protein Tat
    Species: , [TaxId:9606,11665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pk2b1, d2pk2b2
  • Chain 'C':
    Compound: Cyclin-T1, Protein Tat
    Species: , [TaxId:9606,11665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pk2c1, d2pk2c2
  • Chain 'D':
    Compound: Cyclin-T1, Protein Tat
    Species: , [TaxId:9606,11665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pk2d1, d2pk2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pk2A (A:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakktkaddrgtdektseqggtgggsgggsgggsgggt
    sggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkqrlkaiqqgrqpqyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pk2A (A:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriwnwracea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pk2B (B:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakktkaddrgtdektseqggtgggsgggsgggsgggt
    sggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkqrlkaiqqgrqpqyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pk2B (B:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriwnwracea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pk2C (C:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakktkaddrgtdektseqggtgggsgggsgggsgggt
    sggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkqrlkaiqqgrqpqyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pk2C (C:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriwnwracea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pk2D (D:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaakktkaddrgtdektseqggtgggsgggsgggsgggt
    sggvpgqntggqearpnyhcqlcflrslgidyldaslrkknkqrlkaiqqgrqpqyll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pk2D (D:)
    nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
    rfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
    qqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhlttf
    slqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqilek
    tpnrlkriwnwracea