PDB entry 2pjs

View 2pjs on RCSB PDB site
Description: Crystal structure of Atu1953, protein of unknown function
Class: structural genomics, unknown function
Keywords: Agrobacterium tumefaciens, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-04-16, released 2007-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Atu1953
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu1953, AGR_C_3564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pjsa1
  • Chain 'B':
    Compound: Uncharacterized protein Atu1953
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: Atu1953, AGR_C_3564
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pjsb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pjsA (A:)
    qghmavrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfaregg
    sgtdvpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinilsha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjsA (A:)
    avrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtd
    vpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinilsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pjsB (B:)
    qghmavrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfaregg
    sgtdvpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinilsha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjsB (B:)
    avrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtd
    vpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinils