PDB entry 2pjl

View 2pjl on RCSB PDB site
Description: Crystal Structure of Human Estrogen-Related Receptor alpha in Complex with a Synthetic Inverse Agonist reveals its Novel Molecular Mechanism
Class: transcription
Keywords: nuclear hormone receptor, ligand binding domain, ligand binding pocket, three-layered alpha-helical sandwich, inverse agonist, helix 12 (H12), coactivator groove, TRANSCRIPTION
Deposited on 2007-04-16, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid hormone receptor ERR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRA, ERR1, ESRL1, NR3B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11474 (16-End)
      • cloning artifact (9-15)
      • engineered (52)
    Domains in SCOPe 2.08: d2pjla1, d2pjla2
  • Chain 'B':
    Compound: Steroid hormone receptor ERR1
    Species: Homo sapiens [TaxId:9606]
    Gene: ESRRA, ERR1, ESRL1, NR3B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11474 (16-End)
      • cloning artifact (9-15)
      • engineered (52)
    Domains in SCOPe 2.08: d2pjlb1, d2pjlb2
  • Heterogens: 047, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pjlA (A:)
    gsshhhhhhlevlfqgpvnalvshllvvepeklyampdpagpdghlpavatlsdlfdrei
    vvtiswaksipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeeg
    araaglgelgaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealh
    ealleyeagragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklfle
    mleammd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjlA (A:)
    levlfqgpvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslsl
    sdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvr
    rlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrlll
    tlpllrqtagkvlahfygvklegkvpmhklflemleam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pjlB (B:)
    gsshhhhhhlevlfqgpvnalvshllvvepeklyampdpagpdghlpavatlsdlfdrei
    vvtiswaksipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeeg
    araaglgelgaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealh
    ealleyeagragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklfle
    mleammd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjlB (B:)
    levlfqgpvnalvshllvvepeklyamlpavatlsdlfdreivvtiswaksipgfsslsl
    sdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvr
    rlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrlll
    tlpllrqtagkvlahfygvklegkvpmhklflemleam