PDB entry 2pjh

View 2pjh on RCSB PDB site
Description: Strctural Model of the p97 N domain- npl4 UBD complex
Class: transport protein
Keywords: p97, Ufd1, npl4, AAA, Atpase, PROTEIN BINDING, TRANSPORT PROTEIN
Deposited on 2007-04-16, released 2007-05-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nuclear protein localization protein 4 homolog
  Species: Mus musculus [TaxId:10090]
  Gene: p97
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60670
• Chain 'B':
  Compound: Transitional endoplasmic reticulum ATPase
  Species: Mus musculus [TaxId:10090]
  Gene: Npl4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01853 (0-192)
  Domains in SCOPe 2.01: d2pjhb1, d2pjhb2

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pjhB (B:)
  nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
  kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
  eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
  vgyddvggcrkql