PDB entry 2pjh

View 2pjh on RCSB PDB site
Description: Strctural Model of the p97 N domain- npl4 UBD complex
Class: transport protein
Keywords: p97, Ufd1, npl4, AAA, Atpase, PROTEIN BINDING, TRANSPORT PROTEIN
Deposited on 2007-04-16, released 2007-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-30, with a file datestamp of 2007-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear protein localization protein 4 homolog
    Species: MUS MUSCULUS
    Gene: p97
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: MUS MUSCULUS
    Gene: Npl4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pjhb1, d2pjhb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pjhB (B:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddvggcrkql