PDB entry 2piz

View 2piz on RCSB PDB site
Description: CRYSTAL STRUCTURE OF ACTIVATED PORCINE PANCREATIC CARBOXYPEPTIDASE B 2-(3-Guanidino-phenyl)-3-[hydroxy-(3-phenyl-propyl)-phosphinoyl]-propionic acid COMPLEX
Class: hydrolase
Keywords: CARBOXYPEPTIDASE B, EXOPEPTIDASE, Phosphinate BASED INHIBITORS, HYDROLASE
Deposited on 2007-04-15, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.233
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase b
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2piza_
  • Chain 'B':
    Compound: carboxypeptidase b
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pizb_
  • Chain 'C':
    Compound: carboxypeptidase b
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pizc_
  • Heterogens: ZN, 606, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pizA (A:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pizA (A:)
    tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
    dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
    mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
    nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
    attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
    vlghl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pizB (B:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pizB (B:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pizC (C:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pizC (C:)
    tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm
    dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr
    mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir
    nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg
    attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny
    vlghl