PDB entry 2pij

View 2pij on RCSB PDB site
Description: Structure of the Cro protein from prophage Pfl 6 in Pseudomonas fluorescens Pf-5
Class: transcription
Keywords: transcription factor, helix-turn-helix, prophage, structural evolution, TRANSCRIPTION
Deposited on 2007-04-13, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prophage Pfl 6 Cro
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: Prophage Pfl 6 Cro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pija_
  • Chain 'B':
    Compound: Prophage Pfl 6 Cro
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: Prophage Pfl 6 Cro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pijb_
  • Heterogens: SO4, BCT, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pijA (A:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpipa
    rpkrtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pijA (A:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pijB (B:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpipa
    rpkrtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pijB (B:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrsieitlyedgrveaneirpipa