PDB entry 2pih

View 2pih on RCSB PDB site
Description: Crystal structure of Protein ymcA from Bacillus subtilis, NorthEast Structural Genomics target SR375
Class: structural genomics, unknown function
Keywords: ymcA, regulate community development, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-04-13, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ymcA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymcA, BSU17020
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31779
      • modified residue (18)
      • modified residue (95)
    Domains in SCOPe 2.06: d2piha1
  • Chain 'B':
    Compound: Protein ymcA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymcA, BSU17020
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31779
      • modified residue (18)
      • modified residue (95)
    Domains in SCOPe 2.06: d2pihb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pihA (A:)
    mtlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlk
    hyekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiits
    tggdllkgetgskvkhsnnscsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pihA (A:)
    tlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlkh
    yekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiitst
    ggd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pihB (B:)
    mtlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlk
    hyekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiits
    tggdllkgetgskvkhsnnscsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pihB (B:)
    tlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlkh
    yekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiitst
    ggd