PDB entry 2pig

View 2pig on RCSB PDB site
Description: Crystal structure of ydcK from Salmonella cholerae at 2.38 A resolution. Northeast Structural Genomics target SCR6
Class: transferase
Keywords: scr6, nesg, ydcK, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSFERASE
Deposited on 2007-04-13, released 2007-04-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transferase
    Species: Salmonella paratyphi [TaxId:54388]
    Gene: ydcK, SPA1259
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5PHU6
      • modified residue (66)
    Domains in SCOPe 2.01: d2piga_
  • Chain 'B':
    Compound: Putative transferase
    Species: Salmonella paratyphi [TaxId:54388]
    Gene: ydcK, SPA1259
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5PHU6 (Start-325)
      • modified residue (66)
      • cloning artifact (326-329)
    Domains in SCOPe 2.01: d2pigb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pigA (A:)
    mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcw
    iydenamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssv
    reecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatitha
    fiehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehali
    egncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdd
    ntihlrgpkvingedritrtplvgsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pigA (A:)
    kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
    denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
    ecaiygdarvlnqseilaaqilqiydratvnhsrivhqvqlygnatithafiehraevfd
    faliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhv
    lvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddntihlrgpkv
    ingedritrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pigB (B:)
    mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcw
    iydenamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssv
    reecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatitha
    fiehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehali
    egncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdd
    ntihlrgpkvingedritrtplvgsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pigB (B:)
    kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
    denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
    ecaiygdarvlnqseilaiqilqiydratvnhsrivhqvqlygnatithafiehraevfd
    faliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhv
    lvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdntihlrgpkvi
    ngedritrtplvgsllehh