PDB entry 2pie

View 2pie on RCSB PDB site
Description: Crystal structure of the FHA domain of RNF8 in complex with its optimal phosphopeptide
Class: ligase
Keywords: FHA domain, phosphopeptide, complex, LIGASE, SIGNALING PROTEIN
Deposited on 2007-04-13, released 2007-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-11, with a file datestamp of 2007-12-07.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.182
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase RNF8
    Species: HOMO SAPIENS
    Gene: RNF8, KIAA0646
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76064 (4-End)
      • expression tag (0-3)
    Domains in SCOP 1.75: d2piea1
  • Chain 'F':
    Compound: phosphopeptide
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pieA (A:)
gahmaggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlkq
npegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevteed
wetiypclspkndqmiek

    Sequence, based on observed residues (ATOM records): (download) 
    >2pieA (A:)
gahmaggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlkq
npegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevteed
wetiypclspkn

  • Chain 'F':
    No sequence available.