PDB entry 2pid

View 2pid on RCSB PDB site
Description: Crystal structure of human mitochondrial tyrosyl-tRNA synthetase in complex with an adenylate analog
Class: ligase
Keywords: AMINOACYL-TRNA SYNTHETASE, PROTEIN-SUBSTRATE COMPLEX, ATP-binding, Ligase, Mitochondrion, Nucleotide-binding, Protein biosynthesis,
Deposited on 2007-04-13, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pida_
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pidb_
  • Heterogens: YSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pidA (A:)
    mrgshsgaqgllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadsl
    hvghllallglfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlg
    lealaanhqqlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlr
    lkspegmslaeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvf
    gitvplitsttgaklgksagnavwlnrdktspfelyqffvrqpddsverylklftflplp
    eidhimqlhvkeperrgpqkrlaaevtklvhgregldsakrctqalyhrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pidA (A:)
    gllaaqkarglfkdffpetgtkielpelfpqtiycgfdptadslhvghllallglfhlqr
    aghnvialvggatarlgdpsgrtkerealetervranaralrlglealaanhqqlftdgr
    swgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmslaeffyqv
    lqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvfgitvplitavwlnrdk
    tspfelyqffvrqpddsverylklftflplpeidhimqlhvkeperrgpqkrlaaevtkl
    vhgregldsakrctqal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pidB (B:)
    mrgshsgaqgllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadsl
    hvghllallglfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlg
    lealaanhqqlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlr
    lkspegmslaeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvf
    gitvplitsttgaklgksagnavwlnrdktspfelyqffvrqpddsverylklftflplp
    eidhimqlhvkeperrgpqkrlaaevtklvhgregldsakrctqalyhrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pidB (B:)
    gllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadslhvghllall
    glfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlglealaanhq
    qlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmsl
    aeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvfgitvplita
    vwlnrdktspfelyqffvrqpddsverylklftflplpeidhimqlhvkeperrgpqkrl
    aaevtklvhgregldsakrctqal