PDB entry 2pib

View 2pib on RCSB PDB site
Description: Crystal structure of putative beta-phosphoglucomutase from Thermotoga maritima
Class: hydrolase
Keywords: 3D-structure, structural genomics, Thermotoga maritima, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-04-13, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.181
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphorylated carbohydrates phosphatase TM_1254
    Species: Thermotoga maritima [TaxId:243274]
    Gene: bPGM, TM_1254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2piba_
  • Chain 'B':
    Compound: Phosphorylated carbohydrates phosphatase TM_1254
    Species: Thermotoga maritima [TaxId:243274]
    Gene: bPGM, TM_1254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pibb_
  • Heterogens: SO4, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pibA (A:)
    meavifdmdgvlmdteplyfeayrrvaesygkpytedlhrrimgvpereglpilmealei
    kdslenfkkrvheekkrvfsellkenpgvrealefvkskriklalatstpqrealerlrr
    ldlekyfdvmvfgdqvkngkpdpeiyllvlerlnvvpekvvvfedsksgveaaksagier
    iygvvhslndgkalleagavalvkpeeilnvlkevl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pibB (B:)
    meavifdmdgvlmdteplyfeayrrvaesygkpytedlhrrimgvpereglpilmealei
    kdslenfkkrvheekkrvfsellkenpgvrealefvkskriklalatstpqrealerlrr
    ldlekyfdvmvfgdqvkngkpdpeiyllvlerlnvvpekvvvfedsksgveaaksagier
    iygvvhslndgkalleagavalvkpeeilnvlkevl