PDB entry 2pi0

View 2pi0 on RCSB PDB site
Description: Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-B enhancer
Class: transcription activator/DNA
Keywords: Interferon, Protein-DNA complex, Transcription, transcription activator/DNA COMPLEX
Deposited on 2007-04-12, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.185
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pi0a_
  • Chain 'B':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pi0b_
  • Chain 'C':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pi0c_
  • Chain 'D':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pi0d_
  • Chain 'E':
    Compound: PRDIII-I region of human interferon-B promoter strand 1
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: PRDIII-I region of human interferon-B promoter strand 2
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pi0A (A:)
    gshmgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqaw
    aeatgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pi0A (A:)
    kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrgifqawaeatgayvpgrdkpd
    lptwkrnfrsalnrkeglrlaedrskdphdphkiyefv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pi0B (B:)
    gshmgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqaw
    aeatgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pi0B (B:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pi0C (C:)
    gshmgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqaw
    aeatgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pi0C (C:)
    pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
    yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pi0D (D:)
    gshmgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqaw
    aeatgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pi0D (D:)
    tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdagifqawaeatgayvpg
    rdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.