PDB entry 2phl

View 2phl on RCSB PDB site
Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins
Deposited on 1994-07-07, released 1994-09-30
The last revision prior to the SCOP 1.71 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2phlA (A:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlA (A:)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyysk
    aivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftgf
    ginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2phlB (B:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlB (B:)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyysk
    aivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftgf
    ginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2phlC (C:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlC (C:)
    qdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqq
    adaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedl
    riiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqe
    gvivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyys
    kaivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftg
    fginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvda
    h