PDB entry 2phk

View 2phk on RCSB PDB site
Description: the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition
Deposited on 1998-06-18, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.253
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2phka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2phkA (A:)
    gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke
    vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral
    levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape
    iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew
    ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy