PDB entry 2phj

View 2phj on RCSB PDB site
Description: Crystal structure of SurE protein from Aquifex aeolicus
Class: hydrolase
Keywords: SurE protein, putative acid phosphatase, STRUCTURAL GENOMICS, 3-D structure, mixed alpha/beta protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-04-11, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: surE, aq_832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2phja_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: surE, aq_832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2phjb_
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2phjA (A:)
    mptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtd
    fytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgi
    psiafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrq
    gkraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykv
    mksikyledsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phjA (A:)
    ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
    ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
    siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
    kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
    ksikyled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2phjB (B:)
    mptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtd
    fytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgi
    psiafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrq
    gkraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykv
    mksikyledsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phjB (B:)
    ptfllvnddgyfspginalrealkslgrvvvvapdrnlsgvghsltfteplkmrkidtdf
    ytvidgtpadcvhlgyrvileekkpdlvlsginegpnlgeditysgtvsgamegrilgip
    siafsafgrenimfeeiakvcvdivkkvlnegipedtylnvnipnlryeeikgikvtrqg
    kraykervfkyidpygkpfywiaaeefgwhaeegtdywavlngyvsvtplhldltnykvm
    ksikyled