PDB entry 2phi

View 2phi on RCSB PDB site
Description: a large conformational change is found in the crystal structure of the porcine pancreatic phospholipase a2 point mutant f63v
Class: hydrolase (carboxylic ester)
Keywords: hydrolase (carboxylic ester)
Deposited on 1993-04-08, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • conflict (62)
    Domains in SCOPe 2.07: d2phia_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-123)
      • conflict (62)
    Domains in SCOPe 2.07: d2phib_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2phiA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckvlvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2phiB (B:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckvlvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc