PDB entry 2phh

View 2phh on RCSB PDB site
Description: the coenzyme analogue adenosine 5-diphosphoribose displaces fad in the active site of p-hydroxybenzoate hydroxylase. an x-ray crystallographic investigation
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1989-06-19, released 1990-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.168
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-hydroxybenzoate hydroxylase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2phha1, d2phha2
  • Heterogens: APR, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2phhA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpyeeie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phhA (A:)
    mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
    vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
    vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
    ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
    telkarlpaevaeklvtgpsleksiaplrsfvvepmqhgrlflagdaahivpptgakgln
    laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
    qriqqteleyylgseaglatiaenyvglpye