PDB entry 2phg

View 2phg on RCSB PDB site
Description: Model for VP16 binding to TFIIB
Class: transcription
Keywords: TF2B, VP16, transcription, activator
Deposited on 2007-04-11, released 2007-04-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor iib
    Species: HOMO SAPIENS
    Gene: GTF2B, TF2B, TFIIB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00403 (1-205)
      • see remark 999 (0)
    Domains in SCOP 1.75: d2phga1, d2phga2
  • Chain 'B':
    Compound: Alpha trans-inducing protein
    Species: Human herpesvirus 1
    Gene: UL48
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2phgA (A:)
srammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacrq
egvprtfkeicavsriskkeigrcfklilkaletsvdlittgdfmsrfcsnlclpkqvqm
aathiarkaveldlvpgrspisvaaaaiymasqasaekrtqkeigdiagvadvtirqsyr
liyprapdlfptdfkfdtpvdklpql

  • Chain 'B':
    No sequence available.