PDB entry 2ph4

View 2ph4 on RCSB PDB site
Description: Crystal structure of a novel Arg49 phospholipase A2 homologue from Zhaoermia mangshanensis venom
Class: toxin
Keywords: snake venom, arg49, phospholipase A2, myotoxin, TOXIN
Deposited on 2007-04-10, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zhaoermiatoxin
    Species: Zhaoermia mangshanensis [TaxId:242058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ph4a_
  • Chain 'B':
    Compound: Zhaoermiatoxin
    Species: Zhaoermia mangshanensis [TaxId:242058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ph4b_
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ph4A (A:)
slieltkmvfqetgknpvtyytlygcncgvgrrgkpkdatdrccfvhrccykkltgcdpk
kdrysyswenkaivcgeknpclkelcecdkavaiclrknlgtydknyrftmkflcdkpek
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ph4B (B:)
slieltkmvfqetgknpvtyytlygcncgvgrrgkpkdatdrccfvhrccykkltgcdpk
kdrysyswenkaivcgeknpclkelcecdkavaiclrknlgtydknyrftmkflcdkpek
c