PDB entry 2pgh

View 2pgh on RCSB PDB site
Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution
Deposited on 1994-09-16, released 1994-11-30
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.154
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d2pgha_
  • Chain 'B':
    Domains in SCOP 1.63: d2pghb_
  • Chain 'C':
    Domains in SCOP 1.63: d2pghc_
  • Chain 'D':
    Domains in SCOP 1.63: d2pghd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pghA (A:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pghB (B:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pghC (C:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pghD (D:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpdvqaafqkvvagvanalahkyh