PDB entry 2pg9

View 2pg9 on RCSB PDB site
Description: Active Site of Streptococcus pneumoniae Phosphomevalonate Kinase
Class: transferase
Keywords: GHMP Kinase Superfamily, TRANSFERASE
Deposited on 2007-04-09, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphomevalonate kinase
    Species: Streptococcus pneumoniae
    Gene: mvaK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pg9a1, d2pg9a2
  • Heterogens: MG, PMV, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pg9A (A:)
    hmmiavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlr
    pnpdysliqetialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkal
    lalynlsvdqnllfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeen
    latvlerdwgfsisqvkptlecdflvgwtkevavsshmvqqikqninqnfltssketvvs
    lvealeqgksekiieqvevasklleglstdiytpllrqlkeasqdlqavakssgagggdc
    gialsfdaqstktlknrwadlgiellyqerighddks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg9A (A:)
    miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlrpn
    pdysliqetialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkalla
    lynlsvdqnllfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenla
    tvlerdwgfsisqvkptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslv
    ealeqgksekiieqvevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgi
    alsfdaqstktlknrwadlgiellyqeri