PDB entry 2pg2

View 2pg2 on RCSB PDB site
Description: Crystal structure of KSP in complex with ADP and thiophene containing inhibitor 15
Class: motor protein,cell cycle
Keywords: kinesin spindle protein; KSP; Eg5; complex; inhibitor; thiophene, MOTOR PROTEIN,CELL CYCLE
Deposited on 2007-04-06, released 2007-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pg2a_
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2pg2b_
  • Heterogens: MG, ADP, K01, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pg2A (A:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg2A (A:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pg2B (B:)
    masqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladk
    ssrktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegers
    pneeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvse
    rlqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfs
    vtihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvit
    alvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahraknil
    nkpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg2B (B:)
    gkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgas
    tkqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagi
    iprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvi
    ikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeel
    vkigklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrts
    iiatispaslnleetlstleyahraknilnk