PDB entry 2pfv

View 2pfv on RCSB PDB site
Description: S. cerevisiae Exo70 with additional residues to 2.1 Angrstrom resolution
Class: endocytosis/exocytosis
Keywords: helix-turn-helix, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2007-04-05, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exocyst complex component EXO70
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: EXO70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pfva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pfvA (A:)
    gsniestlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqan
    reensefhgilthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlg
    alswildyfhgnsegsiiqdilvgersklilkcmaflepfakeistaknapyekgssgmn
    syteallgfianekslvddlysqyteskphvlsqilsplisayaklfganlkivrsnlen
    fgffsfelvesindvkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansis
    tipsnngvteatvdtmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnw
    edhnvllscfisdcidtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnl
    tlveqivekselnlmlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkksk
    dkeqikekfrkfnegfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsf
    knprkhikytpdelttvlnqlvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pfvA (A:)
    tlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreense
    fhgilthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswil
    dyfhgnsegsiiqdilvgersklilkcmaflepfakeyekgssgmnsyteallgfianek
    slvddlysqyteskphvlsqilsplisayaklfganlkivrsnlenfgffsfelvesind
    vkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansistipsnngvteatvd
    tmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnwedhnvllscfisdc
    idtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnltlveqivekselnl
    mlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkkskdkeqikekfrkfne
    gfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsfknprkhikytpdel
    ttvlnqlvr