PDB entry 2pfs

View 2pfs on RCSB PDB site
Description: Crystal structure of universal stress protein from Nitrosomonas europaea
Class: structural genomics, unknown function
Keywords: stress protein, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-04-05, released 2007-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Universal stress protein
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: NE1028
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82VN8 (2-End)
      • modified residue (2)
      • modified residue (67)
    Domains in SCOPe 2.06: d2pfsa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pfsA (A:)
    ghmsvyhhillavdfssedsqvvqkvrnlasqigarlslihvldnipmpdtpygtaipld
    tettydamldvekqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshgr
    hglalllgstansvlhyakcdvlavrlrdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pfsA (A:)
    msvyhhillavdfssedsqvvqkvrnlasqigarlslihvldtaipldtettydamldve
    kqklsqigntlgidpahrwlvwgepreeiiriaeqenvdlivvgshstansvlhyakcdv
    lavrl