PDB entry 2pf2

View 2pf2 on RCSB PDB site
Description: the ca+2 ion and membrane binding structure of the gla domain of ca-prothrombin fragment 1
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1991-12-08, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prothrombin fragment 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00735 (0-End)
      • conflict (6-7)
      • conflict (14)
      • conflict (16)
      • conflict (19-20)
      • conflict (25-26)
      • conflict (29)
      • conflict (32)
    Domains in SCOPe 2.07: d2pf2a1, d2pf2a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pf2A (A:)
ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
sitgpwcyttsptlrreecsvpvcgqdrvtvevipr

    Sequence, based on observed residues (ATOM records): (download) 
    >2pf2A (A:)
ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
sitgpwcyttsptlrreecsvpvcgq