PDB entry 2pf1

View 2pf1 on RCSB PDB site
Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution
Deposited on 1992-09-17, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2pf1_ (-)
    ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
    clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
    sitgpwcyttsptlrreecsvpvcgqdrvtvevipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pf1_ (-)
    satdafwakytacesarnpreklneclegncaegvgmnyrgnvsvtrsgiecqlwrsryp
    hkpeinstthpgadlrenfcrnpdgsitgpwcyttsptlrreecsvpvcgqdrvtvevip
    r