PDB entry 2pf1

View 2pf1 on RCSB PDB site
Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1992-09-17, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prothrombin fragment 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pf1a1, d2pf1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pf1A (A:)
    ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
    clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
    sitgpwcyttsptlrreecsvpvcgqdrvtvevipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pf1A (A:)
    satdafwakytacesarnpreklneclegncaegvgmnyrgnvsvtrsgiecqlwrsryp
    hkpeinstthpgadlrenfcrnpdgsitgpwcyttsptlrreecsvpvcgqdrvtvevip
    r