PDB entry 2pez

View 2pez on RCSB PDB site
Description: Crystal structrue of deletion mutant of APS-kinase domain of human PAPS-synthetase 1 in complex with cyclic PAPS and dADP
Class: transferase
Keywords: NMP-kinase fold, protein in complex with nucleic acid, TRANSFERASE
Deposited on 2007-04-03, released 2007-05-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-05-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2peza_
  • Chain 'B':
    Compound: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
    Species: Homo sapiens [TaxId:9606]
    Gene: PAPSS1, ATPSK1, PAPSS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2pezb_
  • Heterogens: GGZ, DAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pezA (A:)
    ghmrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedre
    envrriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceq
    rdvkglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pezA (A:)
    rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
    rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
    kglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pezB (B:)
    ghmrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedre
    envrriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceq
    rdvkglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pezB (B:)
    gctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenvr
    riaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdvk
    glyeyekpeapelvlktdscdvndcvqqvvellqerdiv