PDB entry 2pen

View 2pen on RCSB PDB site
Description: Crystal structure of RbcX, crystal form I
Class: chaperone
Keywords: helix bundle, protein complex assembly, chaperone
Deposited on 2007-04-03, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pena_
  • Chain 'B':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2penb_
  • Chain 'C':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2penc_
  • Chain 'D':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pend_
  • Chain 'E':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pene_
  • Chain 'F':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2penf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2penA (A:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penA (A:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2penB (B:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penB (B:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2penC (C:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penC (C:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2penD (D:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penD (D:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2penE (E:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penE (E:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2penF (F:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2penF (F:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvds