PDB entry 2pem

View 2pem on RCSB PDB site
Description: Crystal structure of RbcX in complex with substrate
Class: chaperone
Keywords: helix bundle, protein complex assembly, chaperone
Deposited on 2007-04-03, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pema1
  • Chain 'B':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pemb1
  • Chain 'C':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pemc1
  • Chain 'D':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pemd1
  • Chain 'E':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2peme1
  • Chain 'F':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pemf1
  • Chain 'R':
    Compound: RbcL
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pemA (A:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemA (A:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pemB (B:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemB (B:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pemC (C:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemC (C:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pemD (D:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemD (D:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pemE (E:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemE (E:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pemF (F:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pemF (F:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv
    

  • Chain 'R':
    No sequence available.