PDB entry 2pek

View 2pek on RCSB PDB site
Description: Crystal structure of RbcX point mutant Q29A
Class: chaperone
Keywords: helix bundle, protein complex assembly, chaperone
Deposited on 2007-04-03, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.233
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2peka1
  • Chain 'B':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2pekb_
  • Chain 'C':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2pekc_
  • Chain 'D':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2pekd_
  • Chain 'E':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2peke_
  • Chain 'F':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • engineered (28)
    Domains in SCOPe 2.07: d2pekf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pekA (A:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekA (A:)
    efkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pekB (B:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekB (B:)
    fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pekC (C:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekC (C:)
    efkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pekD (D:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekD (D:)
    efkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pekE (E:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekE (E:)
    fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pekF (F:)
    mefkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqvdssstdqt
    epnpgesdtsedse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pekF (F:)
    fkkvaketaitlqsyltyqavrlisqalsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerltqv