PDB entry 2pei

View 2pei on RCSB PDB site
Description: Crystal structure of selenomethionine-labeled RbcX
Class: chaperone
Keywords: helix bundle, protein complex assembly, chaperone
Deposited on 2007-04-03, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177 (Start-108)
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peia1
  • Chain 'B':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peib_
  • Chain 'C':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peic_
  • Chain 'D':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177 (Start-108)
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peid_
  • Chain 'E':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peie_
  • Chain 'F':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peif_
  • Chain 'G':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177 (Start-108)
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peig_
  • Chain 'H':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177 (Start-108)
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peih_
  • Chain 'I':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peii_
  • Chain 'J':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peij_
  • Chain 'K':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peik_
  • Chain 'L':
    Compound: orf134
    Species: Synechococcus sp. [TaxId:32049]
    Gene: RbcX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q44177 (Start-108)
      • modified residue (59-60)
      • modified residue (88)
    Domains in SCOPe 2.07: d2peil_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2peiA (A:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiA (A:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2peiB (B:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiB (B:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2peiC (C:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiC (C:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrslle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2peiD (D:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiD (D:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2peiE (E:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiE (E:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2peiF (F:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiF (F:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2peiG (G:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiG (G:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2peiH (H:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiH (H:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2peiI (I:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiI (I:)
    efkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamm
    lenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2peiJ (J:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiJ (J:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2peiK (K:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiK (K:)
    kkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleammle
    nkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsller
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2peiL (L:)
    mefkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleam
    mlenkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2peiL (L:)
    fkkvaketaitlqsyltyqavrlisqqlsetnpgqaiwlgefskrhpiqesdlyleamml
    enkelvlriltvrenlaegvleflpemvlsqikqsngnhrrsllerl