PDB entry 2peg

View 2peg on RCSB PDB site
Description: Crystal structure of Trematomus bernacchii hemoglobin in a partial hemichrome state
Class: oxygen storage/transport
Keywords: hemichrome, R/Tintermediate quaternary structure, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2007-04-03, released 2007-07-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-16, with a file datestamp of 2007-10-12.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.199
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Trematomus bernacchii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pega1
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Trematomus bernacchii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pegb1
  • Heterogens: ACE, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pegA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pegB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pegB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgnaeaiignanvaahgi
    kvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmghaftae
    tqgafqkflavvvsalgkqyh